- Recombinant Escherichia coli Inner membrane protein YnjF (ynjF)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1218879
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 22,752 Da
- E Coli or Yeast
- 1-206
- JW1747, ECK1756
- Inner membrane protein YnjF (ynjF)
Sequence
MLDRHLHPRIKPLLHQCVRVLDKPGITPDGLTLVGFAIGVLALPFLALGWYLAALVVILLNRLLDGLDGALARRRELTDAGGFLDISLDFLFYALVPFGFILAAPEQNALAGGWLLFAFIGTGSSFLAFAALAAKHQIDNPGYAHKSFYYLGGLTEGTETILLFVLGCLFPAWFAWFAWIFGALCWMTTFTRVWSGYLTLKSLQRQ